SCOPe 2.05: Domain d3tuye_: 3tuy E:

Lineage for d3tuye_ (3tuy E:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein automated matches [190064] (20 species)
   not a true protein

7. Species Placopecten magellanicus [TaxId:6577] [189594] (3 PDB entries)

8. Domain d3tuye_: 3tuy E: [185962]
   automated match to d1kk7y_
   complexed with ca, mg

Details for d3tuye_

PDB Entry: 3tuy, 2.5 Å

PDB Description: Phosphorylated Light Chain Domain of Scallop smooth Muscle Myosin

PDB Compounds: (E:) myosin regulatory light chain

SCOPe Domain Sequences for d3tuye_:

Sequence; same for both SEQRES and ATOM records:

>d3tuye_ a.39.1.5 (E:) automated matches {Placopecten magellanicus [TaxId: 6577]}
snvfarlpqklmqemkeaftmidqnrdgfidindlkemfsslgrtpddkeltamlkeapg
plnftmflsifsdklsgtdseetirnafgmfdeldtkklnieyikdllenmgdnfnkdem
rmtfkeapveggkfdyvrfvamikgs

Timeline for d3tuye_:

• d3tuye_ first appeared in SCOPe 2.01
  
• d3tuye_ appears in SCOPe 2.04
  
• d3tuye_ appears in SCOPe 2.06
  
• d3tuye_ appears in the current release, SCOPe 2.08