Lineage for d3tuye_ (3tuy E:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2710548Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 2711203Protein automated matches [190064] (21 species)
    not a true protein
  7. 2711347Species Placopecten magellanicus [TaxId:6577] [189594] (3 PDB entries)
  8. 2711358Domain d3tuye_: 3tuy E: [185962]
    automated match to d1kk7y_
    complexed with ca, mg

Details for d3tuye_

PDB Entry: 3tuy (more details), 2.5 Å

PDB Description: Phosphorylated Light Chain Domain of Scallop smooth Muscle Myosin
PDB Compounds: (E:) myosin regulatory light chain

SCOPe Domain Sequences for d3tuye_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tuye_ a.39.1.5 (E:) automated matches {Placopecten magellanicus [TaxId: 6577]}
snvfarlpqklmqemkeaftmidqnrdgfidindlkemfsslgrtpddkeltamlkeapg
plnftmflsifsdklsgtdseetirnafgmfdeldtkklnieyikdllenmgdnfnkdem
rmtfkeapveggkfdyvrfvamikgs

SCOPe Domain Coordinates for d3tuye_:

Click to download the PDB-style file with coordinates for d3tuye_.
(The format of our PDB-style files is described here.)

Timeline for d3tuye_: