Lineage for d3tuyb_ (3tuy B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2319424Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2319425Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2319893Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 2320473Protein automated matches [190064] (22 species)
    not a true protein
  7. 2320569Species Placopecten magellanicus [TaxId:6577] [189594] (3 PDB entries)
  8. 2320578Domain d3tuyb_: 3tuy B: [185960]
    automated match to d1kk7y_
    complexed with ca, mg

Details for d3tuyb_

PDB Entry: 3tuy (more details), 2.5 Å

PDB Description: Phosphorylated Light Chain Domain of Scallop smooth Muscle Myosin
PDB Compounds: (B:) myosin regulatory light chain

SCOPe Domain Sequences for d3tuyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tuyb_ a.39.1.5 (B:) automated matches {Placopecten magellanicus [TaxId: 6577]}
rlpqklmqemkeaftmidqnrdgfidindlkemfsslgrtpddkeltamlkeapgplnft
mflsifsdklsgtdseetirnafgmfdeldtkklnieyikdllenmgdnfnkdemrmtfk
eapveggkfdyvrfvamikgs

SCOPe Domain Coordinates for d3tuyb_:

Click to download the PDB-style file with coordinates for d3tuyb_.
(The format of our PDB-style files is described here.)

Timeline for d3tuyb_: