Lineage for d1ary__ (1ary -)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 49663Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
  4. 49664Superfamily a.93.1: Heme-dependent peroxidases [48113] (2 families) (S)
  5. 49665Family a.93.1.1: Cytochrome c peroxidase-like [48114] (6 proteins)
  6. 49765Protein Peroxidase [48117] (1 species)
  7. 49766Species Arthromyces ramosus [TaxId:5451] [48118] (11 PDB entries)
  8. 49774Domain d1ary__: 1ary - [18596]

Details for d1ary__

PDB Entry: 1ary (more details), 1.9 Å

PDB Description: crystal structures of cyanide-and triiodide-bound forms of arthromyces ramosus peroxidase at different ph values. perturbations of active site residues and their implication in enzyme catalysis

SCOP Domain Sequences for d1ary__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ary__ a.93.1.1 (-) Peroxidase {Arthromyces ramosus}
svtcpggqstsnsqccvwfdvlddlqtnfyqgskcespvrkilrivfhdaigfspaltaa
gqfggggadgsiiahsnielafpanggltdtiealravginhgvsfgdliqfatavgmsn
cpgsprlefltgrsnssqpsppslipgpgntvtaildrmgdagfspdevvdllaahslas
qeglnsaifrspldstpqvfdtqfyietllkgttqpgpslgfaeelspfpgefrmrsdal
lardsrtacrwqsmtssnevmgqryraamakmsvlgfdrnaltdcsdvipsavsnnaapv
ipggltvddievscpsepfpeiatasgplpslapap

SCOP Domain Coordinates for d1ary__:

Click to download the PDB-style file with coordinates for d1ary__.
(The format of our PDB-style files is described here.)

Timeline for d1ary__: