Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins) |
Protein Clp protease, ClpP subunit [52098] (8 species) |
Species Bacillus subtilis [TaxId:1423] [190014] (2 PDB entries) |
Domain d3tt7e_: 3tt7 E: [185947] automated match to d1tyfa_ complexed with dfp |
PDB Entry: 3tt7 (more details), 2.56 Å
SCOPe Domain Sequences for d3tt7e_:
Sequence, based on SEQRES records: (download)
>d3tt7e_ c.14.1.1 (E:) Clp protease, ClpP subunit {Bacillus subtilis [TaxId: 1423]} iptvieqtnrgeraydiysrllkdriimlgsaiddnvansivsqllflaaedpekeisly inspggsitagmaiydtmqfikpkvsticigmaasmgafllaagekgkryalpnsevmih qplggaqgqateieiaakrilllrdklnkvlaertgqplevierdtdrdnfksaeealey glidkilt
>d3tt7e_ c.14.1.1 (E:) Clp protease, ClpP subunit {Bacillus subtilis [TaxId: 1423]} iptviaydiysrllkdriimlgsaiddnvansivsqllflaaedpekeislyinspggsi tagmaiydtmqfikpkvsticigmaasmgafllaagekgkryalpnsevmihqplggaqg qateieiaakrilllrdklnkvlaertgqplevierdtdrdnfksaeealeyglidkilt
Timeline for d3tt7e_: