Lineage for d3tt7e_ (3tt7 E:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 980706Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 980707Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 980708Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins)
  6. 980709Protein Clp protease, ClpP subunit [52098] (8 species)
  7. 980710Species Bacillus subtilis [TaxId:1423] [190014] (2 PDB entries)
  8. 980715Domain d3tt7e_: 3tt7 E: [185947]
    automated match to d1tyfa_
    complexed with dfp

Details for d3tt7e_

PDB Entry: 3tt7 (more details), 2.56 Å

PDB Description: structure of clpp from bacillus subtilis in complex with dfp
PDB Compounds: (E:) ATP-dependent Clp protease proteolytic subunit

SCOPe Domain Sequences for d3tt7e_:

Sequence, based on SEQRES records: (download)

>d3tt7e_ c.14.1.1 (E:) Clp protease, ClpP subunit {Bacillus subtilis [TaxId: 1423]}
iptvieqtnrgeraydiysrllkdriimlgsaiddnvansivsqllflaaedpekeisly
inspggsitagmaiydtmqfikpkvsticigmaasmgafllaagekgkryalpnsevmih
qplggaqgqateieiaakrilllrdklnkvlaertgqplevierdtdrdnfksaeealey
glidkilt

Sequence, based on observed residues (ATOM records): (download)

>d3tt7e_ c.14.1.1 (E:) Clp protease, ClpP subunit {Bacillus subtilis [TaxId: 1423]}
iptviaydiysrllkdriimlgsaiddnvansivsqllflaaedpekeislyinspggsi
tagmaiydtmqfikpkvsticigmaasmgafllaagekgkryalpnsevmihqplggaqg
qateieiaakrilllrdklnkvlaertgqplevierdtdrdnfksaeealeyglidkilt

SCOPe Domain Coordinates for d3tt7e_:

Click to download the PDB-style file with coordinates for d3tt7e_.
(The format of our PDB-style files is described here.)

Timeline for d3tt7e_: