SCOPe 2.01: Domain d3tt6e_: 3tt6 E:

Lineage for d3tt6e_ (3tt6 E:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (5 families)

5. Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins)

6. Protein Clp protease, ClpP subunit [52098] (8 species)

7. Species Bacillus subtilis [TaxId:1423] [190014] (2 PDB entries)

8. Domain d3tt6e_: 3tt6 E: [185940]
   automated match to d1tyfa_

Details for d3tt6e_

PDB Entry: 3tt6, 2.59 Å

PDB Description: structure of clpp from bacillus subtilis in compressed state

PDB Compounds: (E:) ATP-dependent Clp protease proteolytic subunit

SCOPe Domain Sequences for d3tt6e_:

Sequence, based on SEQRES records:

>d3tt6e_ c.14.1.1 (E:) Clp protease, ClpP subunit {Bacillus subtilis [TaxId: 1423]}
iysrllkdriimlgsaiddnvansivsqllflaaedpekeislyinspggsitagmaiyd
tmqfikpkvsticigmaasmgafllaagekgkryalpnsevmihqplggaqgqateieia
akrilllrdklnkvlaertgqplevierdtdrdnfksaeealeyglidkilt

Sequence, based on observed residues (ATOM records):

>d3tt6e_ c.14.1.1 (E:) Clp protease, ClpP subunit {Bacillus subtilis [TaxId: 1423]}
iysrllkdriimlgsaiddnvansivsqllflaaedpekeislyinspggsitagmaiyd
tmqfikpkvsticigmaasmgafllaagekgkryalpnsevmihqeiaakrilllrdkln
kvlaertgqplevierdtdrdnfksaeealeyglidkilt

Timeline for d3tt6e_:

• d3tt6e_ is new in SCOPe 2.01-stable
  
• d3tt6e_ appears in SCOPe 2.02
  
• d3tt6e_ appears in the current release, SCOPe 2.08