Lineage for d1ck6a_ (1ck6 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2002464Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2002465Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2002466Family a.93.1.1: CCP-like [48114] (5 protein domains)
  6. 2002679Protein Fungal peroxidase (ligninase) [88935] (3 species)
  7. 2002680Species Arthromyces ramosus [TaxId:5451] [48118] (14 PDB entries)
  8. 2002689Domain d1ck6a_: 1ck6 A: [18594]
    complexed with bma, ca, hem, sha

Details for d1ck6a_

PDB Entry: 1ck6 (more details), 1.9 Å

PDB Description: binding mode of salicylhydroxamic acid to arthromyces ramosus peroxidase
PDB Compounds: (A:) protein (peroxidase)

SCOPe Domain Sequences for d1ck6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ck6a_ a.93.1.1 (A:) Fungal peroxidase (ligninase) {Arthromyces ramosus [TaxId: 5451]}
svtcpggqstsnsqccvwfdvlddlqtnfyqgskcespvrkilrivfhdaigfspaltaa
gqfggggadgsiiahsnielafpanggltdtiealravginhgvsfgdliqfatavgmsn
cpgsprlefltgrsnssqpsppslipgpgntvtaildrmgdagfspdevvdllaahslas
qeglnsaifrspldstpqvfdtqfyietllkgttqpgpslgfaeelspfpgefrmrsdal
lardsrtacrwqsmtssnevmgqryraamakmsvlgfdrnaltdcsdvipsavsnnaapv
ipggltvddievscpsepfpeiatasgplpslapap

SCOPe Domain Coordinates for d1ck6a_:

Click to download the PDB-style file with coordinates for d1ck6a_.
(The format of our PDB-style files is described here.)

Timeline for d1ck6a_: