![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
![]() | Superfamily c.14.1: ClpP/crotonase [52096] (5 families) ![]() |
![]() | Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins) |
![]() | Protein Clp protease, ClpP subunit [52098] (8 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [190014] (2 PDB entries) |
![]() | Domain d3tt6a_: 3tt6 A: [185936] automated match to d1tyfa_ |
PDB Entry: 3tt6 (more details), 2.59 Å
SCOPe Domain Sequences for d3tt6a_:
Sequence, based on SEQRES records: (download)
>d3tt6a_ c.14.1.1 (A:) Clp protease, ClpP subunit {Bacillus subtilis [TaxId: 1423]} iysrllkdriimlgsaiddnvansivsqllflaaedpekeislyinspggsitagmaiyd tmqfikpkvsticigmaasmgafllaagekgkryalpnsevmihqplggaqgqateieia akrilllrdklnkvlaertgqplevierdtdrdnfksaeealeyglidkilth
>d3tt6a_ c.14.1.1 (A:) Clp protease, ClpP subunit {Bacillus subtilis [TaxId: 1423]} iysrllkdriimlgsaiddnvansivsqllflaaedpekeislyinspggsitagmaiyd tmqfikpkvsticigmaasmgafllaagekgkryalpnsevmihqpeiaakrilllrdkl nkvlaertgqplevierdtdrdnfksaeealeyglidkilth
Timeline for d3tt6a_: