SCOPe 2.08: Domain d3tsmb_: 3tsm B:

Lineage for d3tsmb_ (3tsm B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families)

5. Family c.1.2.0: automated matches [191350] (1 protein)
   not a true family

6. Protein automated matches [190292] (36 species)
   not a true protein

7. Species Brucella melitensis [TaxId:359391] [189740] (1 PDB entry)

8. Domain d3tsmb_: 3tsm B: [185935]
   automated match to d1jcmp_
   complexed with gol, so4, unl

Details for d3tsmb_

PDB Entry: 3tsm, 2.15 Å

PDB Description: Crystal structure of Indole-3-glycerol phosphate synthase from Brucella melitensis

PDB Compounds: (B:) indole-3-glycerol phosphate synthase

SCOPe Domain Sequences for d3tsmb_:

Sequence; same for both SEQRES and ATOM records:

>d3tsmb_ c.1.2.0 (B:) automated matches {Brucella melitensis [TaxId: 359391]}
ilrkieaykreeiaaakarlaldelkartrdqsaprgflkaleakraagqfaliaeikka
spskglirpdfdppalakayeeggaaclsvltdtpsfqgapefltaarqacslpalrkdf
lfdpyqvyearswgadciliimasvdddlakeledtafalgmdalievhdeaemeralkl
ssrllgvnnrnlrsfevnlavserlakmapsdrllvgesgifthedclrleksgigtfli
geslmrqhdvaaatralltg

Timeline for d3tsmb_:

• d3tsmb_ first appeared in SCOPe 2.01
  
• d3tsmb_ appears in SCOPe 2.07