Lineage for d3tscb_ (3tsc B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1830524Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1830525Protein automated matches [190069] (203 species)
    not a true protein
  7. 1831630Species Mycobacterium avium [TaxId:1770] [189537] (2 PDB entries)
  8. 1831636Domain d3tscb_: 3tsc B: [185931]
    automated match to d1g6ka_
    complexed with mpd, nad

Details for d3tscb_

PDB Entry: 3tsc (more details), 2.05 Å

PDB Description: crystal structure of short chain dehydrogenase map_2410 from mycobacterium paratuberculosis bound to nad
PDB Compounds: (B:) Putative oxidoreductase

SCOPe Domain Sequences for d3tscb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tscb_ c.2.1.0 (B:) automated matches {Mycobacterium avium [TaxId: 1770]}
gklegrvafitgaargqgrahavrmaaegadiiavdiagklpscvpydpaspddlsetvr
lveaanrrivaavvdtrdfdrlrkvvddgvaalgrldiivanagvaapqawdditpedfr
dvmdinvtgtwntvmagapriieggrggsiilissaagmkmqpfmihytaskhavtglar
afaaelgkhsirvnsvhpgpvntpmgsgdmvtavgqametnpqlshvltpflpdwvaepe
diadtvcwlasdesrkvtaaqipvdqgstqy

SCOPe Domain Coordinates for d3tscb_:

Click to download the PDB-style file with coordinates for d3tscb_.
(The format of our PDB-style files is described here.)

Timeline for d3tscb_: