Lineage for d3ts5f_ (3ts5 F:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1268646Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1268647Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1269002Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 1269511Protein automated matches [190064] (15 species)
    not a true protein
  7. 1269571Species Placopecten magellanicus [TaxId:6577] [189594] (3 PDB entries)
  8. 1269579Domain d3ts5f_: 3ts5 F: [185929]
    automated match to d1qviz_
    complexed with ca, mg

Details for d3ts5f_

PDB Entry: 3ts5 (more details), 2.39 Å

PDB Description: Crystal Structure of a Light Chain Domain of Scallop Smooth Muscle Myosin
PDB Compounds: (F:) myosin essential light chain

SCOPe Domain Sequences for d3ts5f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ts5f_ a.39.1.5 (F:) automated matches {Placopecten magellanicus [TaxId: 6577]}
klsqdeiddlkevfelfdfwdgrdgavdafkigdvcrclginprnedvfavggthkmgek
slpfeeflpayeglmdceqgtyadymeafktfdregqgfisgaelrhvlsglgerlsdee
vdeiinltdlqedlegnvkyeefvkkvmtgp

SCOPe Domain Coordinates for d3ts5f_:

Click to download the PDB-style file with coordinates for d3ts5f_.
(The format of our PDB-style files is described here.)

Timeline for d3ts5f_: