Lineage for d3tr6a_ (3tr6 A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2145089Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2145090Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2146607Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2146608Protein automated matches [190689] (64 species)
    not a true protein
  7. 2146649Species Coxiella burnetii [TaxId:777] [189725] (2 PDB entries)
  8. 2146654Domain d3tr6a_: 3tr6 A: [185925]
    automated match to d2avda1
    complexed with ni, sah

Details for d3tr6a_

PDB Entry: 3tr6 (more details), 2.7 Å

PDB Description: structure of a o-methyltransferase from coxiella burnetii
PDB Compounds: (A:) O-methyltransferase

SCOPe Domain Sequences for d3tr6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tr6a_ c.66.1.0 (A:) automated matches {Coxiella burnetii [TaxId: 777]}
msinttlltpelyqyllqvslreppllaelreettrsfstyamqtapeqaqllallvklm
qakkvidigtftgysaiamglalpkdgtlitcdvdekstalakeywekaglsdkiglrls
pakdtlaelihagqawqydliyidadkantdlyyeeslkllreggliavdnvlrrgqvad
eenqsennqlirlfnqkvykdervdmilipigdgltlarkks

SCOPe Domain Coordinates for d3tr6a_:

Click to download the PDB-style file with coordinates for d3tr6a_.
(The format of our PDB-style files is described here.)

Timeline for d3tr6a_: