SCOPe 2.01: Domain d3tqsb_: 3tqs B:

Lineage for d3tqsb_ (3tqs B:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families)

5. Family c.66.1.0: automated matches [191451] (1 protein)
   not a true family

6. Protein automated matches [190689] (17 species)
   not a true protein

7. Species Coxiella burnetii [TaxId:777] [189725] (2 PDB entries)

8. Domain d3tqsb_: 3tqs B: [185915]
   automated match to d1qyra_

Details for d3tqsb_

PDB Entry: 3tqs, 1.98 Å

PDB Description: structure of the dimethyladenosine transferase (ksga) from coxiella burnetii

PDB Compounds: (B:) Ribosomal RNA small subunit methyltransferase A

SCOPe Domain Sequences for d3tqsb_:

Sequence; same for both SEQRES and ATOM records:

>d3tqsb_ c.66.1.0 (B:) automated matches {Coxiella burnetii [TaxId: 777]}
qhflhdsfvlqkivsaihpqktdtlveigpgrgaltdylltecdnlalveidrdlvaflq
kkynqqknitiyqndalqfdfssvktdkplrvvgnlpynistpllfhlfsqihciedmhf
mlqkevvrritaevgshdygrlsvmaqyfcdntylftvspqaftppprvesaiirliprh
nftpvaknldqlshvvkeafsyrrktvgnalkklinpsqwplleinpqlrpqeltvedfv
kisniln

Timeline for d3tqsb_:

• d3tqsb_ is new in SCOPe 2.01-stable
  
• d3tqsb_ appears in SCOPe 2.02
  
• d3tqsb_ appears in the current release, SCOPe 2.08