Lineage for d3tqsa_ (3tqs A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 999457Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 999458Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) (S)
  5. 1000528Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 1000529Protein automated matches [190689] (17 species)
    not a true protein
  7. 1000541Species Coxiella burnetii [TaxId:777] [189725] (2 PDB entries)
  8. 1000542Domain d3tqsa_: 3tqs A: [185914]
    automated match to d1qyra_

Details for d3tqsa_

PDB Entry: 3tqs (more details), 1.98 Å

PDB Description: structure of the dimethyladenosine transferase (ksga) from coxiella burnetii
PDB Compounds: (A:) Ribosomal RNA small subunit methyltransferase A

SCOPe Domain Sequences for d3tqsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tqsa_ c.66.1.0 (A:) automated matches {Coxiella burnetii [TaxId: 777]}
qhflhdsfvlqkivsaihpqktdtlveigpgrgaltdylltecdnlalveidrdlvaflq
kkynqqknitiyqndalqfdfssvktdkplrvvgnlpynistpllfhlfsqihciedmhf
mlqkevvrritaevgshdygrlsvmaqyfcdntylftvspqaftppprvesaiirliprh
nftpvaknldqlshvvkeafsyrrktvgnalkklinpsqwplleinpqlrpqeltvedfv
kisniln

SCOPe Domain Coordinates for d3tqsa_:

Click to download the PDB-style file with coordinates for d3tqsa_.
(The format of our PDB-style files is described here.)

Timeline for d3tqsa_: