Lineage for d3tqra_ (3tqr A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892510Fold c.65: Formyltransferase [53327] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214567; strand 6 is antiparallel to the rest
  4. 2892511Superfamily c.65.1: Formyltransferase [53328] (2 families) (S)
  5. 2892629Family c.65.1.0: automated matches [191608] (1 protein)
    not a true family
  6. 2892630Protein automated matches [191110] (11 species)
    not a true protein
  7. 2892653Species Coxiella burnetii [TaxId:777] [189726] (2 PDB entries)
  8. 2892654Domain d3tqra_: 3tqr A: [185913]
    automated match to d1c2ta_
    complexed with cl, nhe

Details for d3tqra_

PDB Entry: 3tqr (more details), 1.97 Å

PDB Description: structure of the phosphoribosylglycinamide formyltransferase (purn) in complex with ches from coxiella burnetii
PDB Compounds: (A:) phosphoribosylglycinamide formyltransferase

SCOPe Domain Sequences for d3tqra_:

Sequence, based on SEQRES records: (download)

>d3tqra_ c.65.1.0 (A:) automated matches {Coxiella burnetii [TaxId: 777]}
eplpivvlisgngtnlqaiigaiqkglaieiravisnradayglkraqqadipthiiphe
efpsrtdfestlqktidhydpklivlagfmrklgkafvshysgrminihpsllpkytgln
theralaagetehgvsvhyvtedldagplicqarlsitpqdtpetlktrvhalehiiype
vlswfaagrlnyhnnqvfldgkplaksghafp

Sequence, based on observed residues (ATOM records): (download)

>d3tqra_ c.65.1.0 (A:) automated matches {Coxiella burnetii [TaxId: 777]}
eplpivvlisgngtnlqaiigaiqkglaieiravisnradayglkraqqadipthiiphe
efpsrtdfestlqktidhydpklivlagfmrklgkafvshysgrminihpsllpkytgln
theralaagetehgvsvhyvtdldagplicqarlsitpqdtpetlktrvhalehiiypev
lswfaagrlnyhnnqvfldgkplaksghafp

SCOPe Domain Coordinates for d3tqra_:

Click to download the PDB-style file with coordinates for d3tqra_.
(The format of our PDB-style files is described here.)

Timeline for d3tqra_: