![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.65: Formyltransferase [53327] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214567; strand 6 is antiparallel to the rest |
![]() | Superfamily c.65.1: Formyltransferase [53328] (2 families) ![]() |
![]() | Family c.65.1.0: automated matches [191608] (1 protein) not a true family |
![]() | Protein automated matches [191110] (11 species) not a true protein |
![]() | Species Coxiella burnetii [TaxId:777] [189726] (2 PDB entries) |
![]() | Domain d3tqra_: 3tqr A: [185913] automated match to d1c2ta_ complexed with cl, nhe |
PDB Entry: 3tqr (more details), 1.97 Å
SCOPe Domain Sequences for d3tqra_:
Sequence, based on SEQRES records: (download)
>d3tqra_ c.65.1.0 (A:) automated matches {Coxiella burnetii [TaxId: 777]} eplpivvlisgngtnlqaiigaiqkglaieiravisnradayglkraqqadipthiiphe efpsrtdfestlqktidhydpklivlagfmrklgkafvshysgrminihpsllpkytgln theralaagetehgvsvhyvtedldagplicqarlsitpqdtpetlktrvhalehiiype vlswfaagrlnyhnnqvfldgkplaksghafp
>d3tqra_ c.65.1.0 (A:) automated matches {Coxiella burnetii [TaxId: 777]} eplpivvlisgngtnlqaiigaiqkglaieiravisnradayglkraqqadipthiiphe efpsrtdfestlqktidhydpklivlagfmrklgkafvshysgrminihpsllpkytgln theralaagetehgvsvhyvtdldagplicqarlsitpqdtpetlktrvhalehiiypev lswfaagrlnyhnnqvfldgkplaksghafp
Timeline for d3tqra_: