![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.103: Citrate synthase [48255] (1 superfamily) multihelical; consists of two all-alpha domains |
![]() | Superfamily a.103.1: Citrate synthase [48256] (2 families) ![]() |
![]() | Family a.103.1.0: automated matches [191476] (1 protein) not a true family |
![]() | Protein automated matches [190763] (13 species) not a true protein |
![]() | Species Coxiella burnetii [TaxId:777] [189724] (1 PDB entry) |
![]() | Domain d3tqgb_: 3tqg B: [185911] automated match to d1a59a_ |
PDB Entry: 3tqg (more details), 2.3 Å
SCOPe Domain Sequences for d3tqgb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tqgb_ a.103.1.0 (B:) automated matches {Coxiella burnetii [TaxId: 777]} qsagetsiatvgkeghgltyrgyriedlaanatfeevaylllknklptkseldaytkklv nlrslppalkdtleripasshpmdvmrtgcsmlgnlepengfeneqniadrlvaifpaiq cywyhyshhgkridtelddltlagyflhlllgkkaaqmaidcmnaslilyaehefnastf aarvcsatlsdiysavtaaiatlrgplhgganeaamdlimlyktpseaiagikrklanke limgfghavyrerdprnaiikswaqklapnaadgylfdisdaientmqdekklfpnldfy satayhflniptklftpifvmsrvtgwcahifeqrkdnriirpnadyigpeeqgwvpiek rr
Timeline for d3tqgb_: