Lineage for d3tqgb_ (3tqg B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004800Fold a.103: Citrate synthase [48255] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2004801Superfamily a.103.1: Citrate synthase [48256] (2 families) (S)
  5. 2004906Family a.103.1.0: automated matches [191476] (1 protein)
    not a true family
  6. 2004907Protein automated matches [190763] (6 species)
    not a true protein
  7. 2004908Species Coxiella burnetii [TaxId:777] [189724] (1 PDB entry)
  8. 2004910Domain d3tqgb_: 3tqg B: [185911]
    automated match to d1a59a_

Details for d3tqgb_

PDB Entry: 3tqg (more details), 2.3 Å

PDB Description: structure of the 2-methylcitrate synthase (prpc) from coxiella burnetii
PDB Compounds: (B:) 2-methylcitrate synthase

SCOPe Domain Sequences for d3tqgb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tqgb_ a.103.1.0 (B:) automated matches {Coxiella burnetii [TaxId: 777]}
qsagetsiatvgkeghgltyrgyriedlaanatfeevaylllknklptkseldaytkklv
nlrslppalkdtleripasshpmdvmrtgcsmlgnlepengfeneqniadrlvaifpaiq
cywyhyshhgkridtelddltlagyflhlllgkkaaqmaidcmnaslilyaehefnastf
aarvcsatlsdiysavtaaiatlrgplhgganeaamdlimlyktpseaiagikrklanke
limgfghavyrerdprnaiikswaqklapnaadgylfdisdaientmqdekklfpnldfy
satayhflniptklftpifvmsrvtgwcahifeqrkdnriirpnadyigpeeqgwvpiek
rr

SCOPe Domain Coordinates for d3tqgb_:

Click to download the PDB-style file with coordinates for d3tqgb_.
(The format of our PDB-style files is described here.)

Timeline for d3tqgb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3tqga_