Lineage for d3tqda_ (3tqd A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2133075Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2133076Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2133953Family c.68.1.0: automated matches [191551] (1 protein)
    not a true family
  6. 2133954Protein automated matches [190951] (26 species)
    not a true protein
  7. 2133988Species Coxiella burnetii [TaxId:777] [189775] (1 PDB entry)
  8. 2133989Domain d3tqda_: 3tqd A: [185909]
    automated match to d1vicb_
    complexed with act, ni

Details for d3tqda_

PDB Entry: 3tqd (more details), 1.8 Å

PDB Description: structure of the 3-deoxy-d-manno-octulosonate cytidylyltransferase (kdsb) from coxiella burnetii
PDB Compounds: (A:) 3-deoxy-manno-octulosonate cytidylyltransferase

SCOPe Domain Sequences for d3tqda_:

Sequence, based on SEQRES records: (download)

>d3tqda_ c.68.1.0 (A:) automated matches {Coxiella burnetii [TaxId: 777]}
efrviiparfdstrlpgkalvdiagkpmiqhvyesaiksgaeevviatddkrirqvaedf
gavvcmtssdhqsgteriaeaavalgfeddeiivclqgdeplippdairklaedldehdn
vkvaslctpitevdelfnphstkvvlnrrnyalyfshapipwgrdtfsdkenlqlngshy
rhvgiyayrvgfleeylswdacpaekmealeqlrilwhggrihmvvakskcppgvdteed
lervrayf

Sequence, based on observed residues (ATOM records): (download)

>d3tqda_ c.68.1.0 (A:) automated matches {Coxiella burnetii [TaxId: 777]}
efrviiparfdlpgkalvdiagkpmiqhvyesaiksgaeevviatddkrirqvaedfgav
vcmtssdhqsgteriaeaavalgfeddeiivclqgdeplippdairklaedldehdkvas
lctpitevdelfnphstkvvlnrrnyalyfshapipwgrdtfsdkenlqlngshyrhvgi
yayrvgfleeylswdacpaekmealeqlrilwhggrihmvvakskcppgvdteedlervr
ayf

SCOPe Domain Coordinates for d3tqda_:

Click to download the PDB-style file with coordinates for d3tqda_.
(The format of our PDB-style files is described here.)

Timeline for d3tqda_: