SCOPe 2.06: Domain d3tq8a1: 3tq8 A:1-161

Lineage for d3tq8a1 (3tq8 A:1-161)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.0: automated matches [191485] (1 protein)
   not a true family

6. Protein automated matches [190777] (21 species)
   not a true protein

7. Species Coxiella burnetii [TaxId:777] [189790] (4 PDB entries)

8. Domain d3tq8a1: 3tq8 A:1-161 [185905]
   Other proteins in same PDB: d3tq8a2
   automated match to d1ddra_
   complexed with ndp, top

Details for d3tq8a1

PDB Entry: 3tq8, 1.9 Å

PDB Description: structure of the dihydrofolate reductase (fola) from coxiella burnetii in complex with trimethoprim

PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d3tq8a1:

Sequence, based on SEQRES records:

>d3tq8a1 c.71.1.0 (A:1-161) automated matches {Coxiella burnetii [TaxId: 777]}
miitliaamdknrligrnnelpwhlpadlahfksitlgkpivmgrrtfdsigkplphrrn
ivitqqknliiegcdifyslddalsaltkepeviiiggarifkealpkadkmiltiinhs
fegdvyfpewndkewkitsqikherdeknpypfqflelrrl

Sequence, based on observed residues (ATOM records):

>d3tq8a1 c.71.1.0 (A:1-161) automated matches {Coxiella burnetii [TaxId: 777]}
miitliaamdknrligrnnelpwhlpadlahfksitlgkpivmgrrtfdsigkplphrrn
ivitqqknliiegcdifyslddalsaltkepeviiiggarifkealpkadkmiltiinhs
fegdvyfpewndkewkitsqikherdnpypfqflelrrl

Timeline for d3tq8a1:

• d3tq8a1 first appeared in SCOPe 2.01, called d3tq8a_
  
• d3tq8a1 was called d3tq8a_ in SCOPe 2.05
  
• d3tq8a1 appears in SCOPe 2.07
  
• d3tq8a1 appears in the current release, SCOPe 2.08