Lineage for d3tq8a1 (3tq8 A:1-161)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2153715Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 2153716Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 2154171Family c.71.1.0: automated matches [191485] (1 protein)
    not a true family
  6. 2154172Protein automated matches [190777] (21 species)
    not a true protein
  7. 2154289Species Coxiella burnetii [TaxId:777] [189790] (4 PDB entries)
  8. 2154290Domain d3tq8a1: 3tq8 A:1-161 [185905]
    Other proteins in same PDB: d3tq8a2
    automated match to d1ddra_
    complexed with ndp, top

Details for d3tq8a1

PDB Entry: 3tq8 (more details), 1.9 Å

PDB Description: structure of the dihydrofolate reductase (fola) from coxiella burnetii in complex with trimethoprim
PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d3tq8a1:

Sequence, based on SEQRES records: (download)

>d3tq8a1 c.71.1.0 (A:1-161) automated matches {Coxiella burnetii [TaxId: 777]}
miitliaamdknrligrnnelpwhlpadlahfksitlgkpivmgrrtfdsigkplphrrn
ivitqqknliiegcdifyslddalsaltkepeviiiggarifkealpkadkmiltiinhs
fegdvyfpewndkewkitsqikherdeknpypfqflelrrl

Sequence, based on observed residues (ATOM records): (download)

>d3tq8a1 c.71.1.0 (A:1-161) automated matches {Coxiella burnetii [TaxId: 777]}
miitliaamdknrligrnnelpwhlpadlahfksitlgkpivmgrrtfdsigkplphrrn
ivitqqknliiegcdifyslddalsaltkepeviiiggarifkealpkadkmiltiinhs
fegdvyfpewndkewkitsqikherdnpypfqflelrrl

SCOPe Domain Coordinates for d3tq8a1:

Click to download the PDB-style file with coordinates for d3tq8a1.
(The format of our PDB-style files is described here.)

Timeline for d3tq8a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3tq8a2