Lineage for d3tq8a_ (3tq8 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1871769Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 1871770Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 1872191Family c.71.1.0: automated matches [191485] (1 protein)
    not a true family
  6. 1872192Protein automated matches [190777] (19 species)
    not a true protein
  7. 1872309Species Coxiella burnetii [TaxId:777] [189790] (4 PDB entries)
  8. 1872310Domain d3tq8a_: 3tq8 A: [185905]
    automated match to d1ddra_
    complexed with ndp, top

Details for d3tq8a_

PDB Entry: 3tq8 (more details), 1.9 Å

PDB Description: structure of the dihydrofolate reductase (fola) from coxiella burnetii in complex with trimethoprim
PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d3tq8a_:

Sequence, based on SEQRES records: (download)

>d3tq8a_ c.71.1.0 (A:) automated matches {Coxiella burnetii [TaxId: 777]}
miitliaamdknrligrnnelpwhlpadlahfksitlgkpivmgrrtfdsigkplphrrn
ivitqqknliiegcdifyslddalsaltkepeviiiggarifkealpkadkmiltiinhs
fegdvyfpewndkewkitsqikherdeknpypfqflelrrlenlyfqghhhhh

Sequence, based on observed residues (ATOM records): (download)

>d3tq8a_ c.71.1.0 (A:) automated matches {Coxiella burnetii [TaxId: 777]}
miitliaamdknrligrnnelpwhlpadlahfksitlgkpivmgrrtfdsigkplphrrn
ivitqqknliiegcdifyslddalsaltkepeviiiggarifkealpkadkmiltiinhs
fegdvyfpewndkewkitsqikherdnpypfqflelrrlenlyfqghhhhh

SCOPe Domain Coordinates for d3tq8a_:

Click to download the PDB-style file with coordinates for d3tq8a_.
(The format of our PDB-style files is described here.)

Timeline for d3tq8a_: