Lineage for d3tpma_ (3tpm A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332674Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2332675Superfamily a.118.1: ARM repeat [48371] (27 families) (S)
  5. 2332676Family a.118.1.1: Armadillo repeat [48372] (7 protein domains)
  6. 2332717Protein Importin alpha [48376] (1 species)
  7. 2332718Species Mouse (Mus musculus) [TaxId:10090] [48377] (30 PDB entries)
  8. 2332721Domain d3tpma_: 3tpm A: [185902]
    automated match to d1ejli_

Details for d3tpma_

PDB Entry: 3tpm (more details), 2.1 Å

PDB Description: Crystal structure of MAL RPEL domain in complex with importin-alpha
PDB Compounds: (A:) Importin subunit alpha-2

SCOPe Domain Sequences for d3tpma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tpma_ a.118.1.1 (A:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]}
nwsvedivkginsnnlesqlqatqaarkllsrekqppidniiraglipkfvsflgktdcs
piqfesawaltniasgtseqtkavvdggaipafisllasphahiseqavwalgniagdgs
afrdlvikhgaidpllallavpdlstlacgylrnltwtlsnlcrnknpappldaveqilp
tlvrllhhndpevladscwaisyltdgpneriemvvkkgvvpqlvkllgatelpivtpal
raignivtgtdeqtqkvidagalavfpslltnpktniqkeatwtmsnitagrqdqiqqvv
nhglvpflvgvlskadfktqkeaawaitnytsggtveqivylvhcgiieplmnllsakdt
kiiqvildaisnifqaaeklgeteklsimieecggldkiealqrhenesvykaslnliek
yf

SCOPe Domain Coordinates for d3tpma_:

Click to download the PDB-style file with coordinates for d3tpma_.
(The format of our PDB-style files is described here.)

Timeline for d3tpma_: