Lineage for d3tpma_ (3tpm A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2006337Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2006338Family a.118.1.1: Armadillo repeat [48372] (7 protein domains)
  6. 2006377Protein Importin alpha [48376] (1 species)
  7. 2006378Species Mouse (Mus musculus) [TaxId:10090] [48377] (30 PDB entries)
  8. 2006383Domain d3tpma_: 3tpm A: [185902]
    automated match to d1ejli_

Details for d3tpma_

PDB Entry: 3tpm (more details), 2.1 Å

PDB Description: Crystal structure of MAL RPEL domain in complex with importin-alpha
PDB Compounds: (A:) Importin subunit alpha-2

SCOPe Domain Sequences for d3tpma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tpma_ a.118.1.1 (A:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]}
nwsvedivkginsnnlesqlqatqaarkllsrekqppidniiraglipkfvsflgktdcs
piqfesawaltniasgtseqtkavvdggaipafisllasphahiseqavwalgniagdgs
afrdlvikhgaidpllallavpdlstlacgylrnltwtlsnlcrnknpappldaveqilp
tlvrllhhndpevladscwaisyltdgpneriemvvkkgvvpqlvkllgatelpivtpal
raignivtgtdeqtqkvidagalavfpslltnpktniqkeatwtmsnitagrqdqiqqvv
nhglvpflvgvlskadfktqkeaawaitnytsggtveqivylvhcgiieplmnllsakdt
kiiqvildaisnifqaaeklgeteklsimieecggldkiealqrhenesvykaslnliek
yf

SCOPe Domain Coordinates for d3tpma_:

Click to download the PDB-style file with coordinates for d3tpma_.
(The format of our PDB-style files is described here.)

Timeline for d3tpma_: