Lineage for d3tpaa1 (3tpa A:8-513)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2144291Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2144292Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2145531Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2145532Protein automated matches [190039] (138 species)
    not a true protein
  7. 2145822Species Haemophilus parasuis [TaxId:456298] [189829] (1 PDB entry)
  8. 2145823Domain d3tpaa1: 3tpa A:8-513 [185901]
    Other proteins in same PDB: d3tpaa2
    automated match to d1dppa_

Details for d3tpaa1

PDB Entry: 3tpa (more details), 2 Å

PDB Description: Structure of HbpA2 from Haemophilus parasuis
PDB Compounds: (A:) heme-binding protein a

SCOPe Domain Sequences for d3tpaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tpaa1 c.94.1.0 (A:8-513) automated matches {Haemophilus parasuis [TaxId: 456298]}
ntlvnciatapmklspaitndandfnassqqvynrlvefkagkievepglaerweisedg
lvytfylrqnvkfhsnktfsptrplnaddvvfsfqrqadknhpyhnvsagtyfyfnwmnl
psilksvekvddytvkitlnkpntpfittvamdflsiyskeyadqllaqgkpetldqqpi
gtgpfifqtnqtdhavrytanvdywkgkadierlifsitpdagtryaklkagecdvidfp
nisdiaqmkkdpqinllereglnlayiglnttkpelnnvkvrqalhhatdkkaivdavyq
gggtvatnpfpdavlgynphlpqyefnlekakallaeagypngfeteiwvqpvvrpsnpn
prrtaeiiqadwakigvkaklvthewadfnkrtregefaagtygwtsrngdpdnflfplf
sqanipgtnysrwtdekfeallasaaqiqdtqtraklyqqaveifqqnspiipfahsiny
vplnkrvqgfvqnpfgytafygvslk

SCOPe Domain Coordinates for d3tpaa1:

Click to download the PDB-style file with coordinates for d3tpaa1.
(The format of our PDB-style files is described here.)

Timeline for d3tpaa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3tpaa2