SCOPe 2.01: Domain d3torc_: 3tor C:

Lineage for d3torc_ (3tor C:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
   variable number of helices and little beta structure; not a true fold

4. Superfamily a.138.1: Multiheme cytochromes [48695] (3 families)
   duplication: contains multiple CxxCH motifs

5. Family a.138.1.3: Di-heme elbow motif [48711] (8 proteins)
   the main characteristic feature of this motif is the packing of its two hemes
   many members contains one or more complete motifs flanked by incomplete motifs and/or other domains

6. Protein automated matches [190276] (5 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [187218] (2 PDB entries)

8. Domain d3torc_: 3tor C: [185899]
   automated match to d1gu6a_
   complexed with ca, eu, hec

Details for d3torc_

PDB Entry: 3tor, 2 Å

PDB Description: Crystal structure of Escherichia coli NrfA with Europium bound

PDB Compounds: (C:) cytochrome c nitrite reductase

SCOPe Domain Sequences for d3torc_:

Sequence; same for both SEQRES and ATOM records:

>d3torc_ a.138.1.3 (C:) automated matches {Escherichia coli [TaxId: 562]}
tveaknetfapqhpdqylswkatseqservdalaedprlvilwagypfsrdynkprghaf
avtdvretlrtgapknaedgplpmacwsckspdvarliqkdgedgyfhgkwarggpeivn
nlgcadchntaspefakgkpeltlsrpyaarameaigkpfekagrfdqqsmvcgqchvey
yfdgknkavkfpwddgmkvenmeqyydkiafsdwtnslsktpmlkaqhpeyetwtagihg
knnvtcidchmpkvqnaegklytdhkignpfdnfaqtcanchtqdkaalqkvvaerkqsi
ndlkikvedqlvhahfeakaaldagateaemkpiqddirhaqwrwdlaiashgihmhape
eglrmlgtamdkaadartklarllatkgitheiqipdistkekaqqaiglnmeqikaekq
dfiktvipqweeqarknglls

Timeline for d3torc_:

• d3torc_ is new in SCOPe 2.01-stable
  
• d3torc_ appears in SCOPe 2.02
  
• d3torc_ appears in the current release, SCOPe 2.08