Lineage for d3torc_ (3tor C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2734165Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
    variable number of helices and little beta structure; not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 2734166Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) (S)
    duplication: contains multiple CxxCH motifs
  5. 2734319Family a.138.1.3: Di-heme elbow motif [48711] (8 proteins)
    the main characteristic feature of this motif is the packing of its two hemes
    many members contains one or more complete motifs flanked by incomplete motifs and/or other domains
  6. 2734414Protein automated matches [190276] (12 species)
    not a true protein
  7. 2734442Species Escherichia coli [TaxId:562] [187218] (2 PDB entries)
  8. 2734445Domain d3torc_: 3tor C: [185899]
    automated match to d1gu6a_
    complexed with ca, eu, hec

Details for d3torc_

PDB Entry: 3tor (more details), 2 Å

PDB Description: Crystal structure of Escherichia coli NrfA with Europium bound
PDB Compounds: (C:) cytochrome c nitrite reductase

SCOPe Domain Sequences for d3torc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3torc_ a.138.1.3 (C:) automated matches {Escherichia coli [TaxId: 562]}
tveaknetfapqhpdqylswkatseqservdalaedprlvilwagypfsrdynkprghaf
avtdvretlrtgapknaedgplpmacwsckspdvarliqkdgedgyfhgkwarggpeivn
nlgcadchntaspefakgkpeltlsrpyaarameaigkpfekagrfdqqsmvcgqchvey
yfdgknkavkfpwddgmkvenmeqyydkiafsdwtnslsktpmlkaqhpeyetwtagihg
knnvtcidchmpkvqnaegklytdhkignpfdnfaqtcanchtqdkaalqkvvaerkqsi
ndlkikvedqlvhahfeakaaldagateaemkpiqddirhaqwrwdlaiashgihmhape
eglrmlgtamdkaadartklarllatkgitheiqipdistkekaqqaiglnmeqikaekq
dfiktvipqweeqarknglls

SCOPe Domain Coordinates for d3torc_:

Click to download the PDB-style file with coordinates for d3torc_.
(The format of our PDB-style files is described here.)

Timeline for d3torc_: