Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
Superfamily d.22.1: GFP-like [54511] (3 families) |
Family d.22.1.0: automated matches [191400] (1 protein) not a true family |
Protein automated matches [190526] (26 species) not a true protein |
Species Lobophyllia hemprichii [TaxId:46758] [187486] (25 PDB entries) |
Domain d3tmtd_: 3tmt D: [185890] Other proteins in same PDB: d3tmta2 automated match to d1mova_ complexed with so4 |
PDB Entry: 3tmt (more details), 2 Å
SCOPe Domain Sequences for d3tmtd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tmtd_ d.22.1.0 (D:) automated matches {Lobophyllia hemprichii [TaxId: 46758]} msaikpdmkinlrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdiltta fhygnrvfaeypdhiqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkvrf hgvnfpangpvmqkktlkwepstekmyvrdgvltgditmalllegnahyrcdsrttykak ekgvklpgyhlvdhcieilshdkdynkvklyehavahsglpdn
Timeline for d3tmtd_:
View in 3D Domains from other chains: (mouse over for more information) d3tmta1, d3tmta2, d3tmtb_, d3tmtc_ |