Lineage for d1aru__ (1aru -)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 99645Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
  4. 99646Superfamily a.93.1: Heme-dependent peroxidases [48113] (2 families) (S)
  5. 99647Family a.93.1.1: Cytochrome c peroxidase-like [48114] (6 proteins)
  6. 99748Protein Peroxidase [48117] (1 species)
  7. 99749Species Arthromyces ramosus [TaxId:5451] [48118] (11 PDB entries)
  8. 99750Domain d1aru__: 1aru - [18589]

Details for d1aru__

PDB Entry: 1aru (more details), 1.6 Å

PDB Description: crystal structures of cyanide-and triiodide-bound forms of arthromyces ramosus peroxidase at different ph values. perturbations of active site residues and their implication in enzyme catalysis

SCOP Domain Sequences for d1aru__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aru__ a.93.1.1 (-) Peroxidase {Arthromyces ramosus}
svtcpggqstsnsqccvwfdvlddlqtnfyqgskcespvrkilrivfhdaigfspaltaa
gqfggggadgsiiahsnielafpanggltdtiealravginhgvsfgdliqfatavgmsn
cpgsprlefltgrsnssqpsppslipgpgntvtaildrmgdagfspdevvdllaahslas
qeglnsaifrspldstpqvfdtqfyietllkgttqpgpslgfaeelspfpgefrmrsdal
lardsrtacrwqsmtssnevmgqryraamakmsvlgfdrnaltdcsdvipsavsnnaapv
ipggltvddievscpsepfpeiatasgplpslapap

SCOP Domain Coordinates for d1aru__:

Click to download the PDB-style file with coordinates for d1aru__.
(The format of our PDB-style files is described here.)

Timeline for d1aru__: