SCOPe 2.04: Domain d3tmtc_: 3tmt C:

Lineage for d3tmtc_ (3tmt C:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.0: automated matches [191400] (1 protein)
   not a true family

6. Protein automated matches [190526] (18 species)
   not a true protein

7. Species Lobophyllia hemprichii [TaxId:46758] [187486] (12 PDB entries)

8. Domain d3tmtc_: 3tmt C: [185889]
   automated match to d1mova_
   complexed with so4

Details for d3tmtc_

PDB Entry: 3tmt, 2 Å

PDB Description: IrisFP, distorted chromophore

PDB Compounds: (C:) green to red photoconvertible gpf-like protein eosfp

SCOPe Domain Sequences for d3tmtc_:

Sequence; same for both SEQRES and ATOM records:

>d3tmtc_ d.22.1.0 (C:) automated matches {Lobophyllia hemprichii [TaxId: 46758]}
saikpdmkinlrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdilttaf
hygnrvfaeypdhiqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkvrfh
gvnfpangpvmqkktlkwepstekmyvrdgvltgditmalllegnahyrcdsrttykake
kgvklpgyhlvdhcieilshdkdynkvklyehavahsglpdn

Timeline for d3tmtc_:

• d3tmtc_ first appeared in SCOPe 2.01
  
• d3tmtc_ appears in SCOPe 2.03
  
• d3tmtc_ appears in SCOPe 2.05
  
• d3tmtc_ appears in the current release, SCOPe 2.08