![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
![]() | Superfamily d.22.1: GFP-like [54511] (3 families) ![]() |
![]() | Family d.22.1.0: automated matches [191400] (1 protein) not a true family |
![]() | Protein automated matches [190526] (26 species) not a true protein |
![]() | Species Lobophyllia hemprichii [TaxId:46758] [187486] (25 PDB entries) |
![]() | Domain d3tmra1: 3tmr A:1-223 [185883] Other proteins in same PDB: d3tmra2 automated match to d1mova_ complexed with so3, so4 |
PDB Entry: 3tmr (more details), 2 Å
SCOPe Domain Sequences for d3tmra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tmra1 d.22.1.0 (A:1-223) automated matches {Lobophyllia hemprichii [TaxId: 46758]} msaikpdmkinlrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdiltta fhygnrvfaeypdhiqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkvrf hgvnfpangpvmqkktlkwepstekmyvrdgvltgditmalllegnahyrcdsrttykak ekgvklpgyhlvdhcieilshdkdynkvklyehavahsglpdn
Timeline for d3tmra1: