Lineage for d1lgab_ (1lga B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2002464Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2002465Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2002466Family a.93.1.1: CCP-like [48114] (5 protein domains)
  6. 2002679Protein Fungal peroxidase (ligninase) [88935] (3 species)
  7. 2002695Species Basidomycetes fungus (Phanerochaete chrysosporium) [TaxId:5306] [48116] (9 PDB entries)
  8. 2002706Domain d1lgab_: 1lga B: [18588]
    complexed with ca, hem, nag

Details for d1lgab_

PDB Entry: 1lga (more details), 2.03 Å

PDB Description: crystallographic refinement of lignin peroxidase at 2 angstroms
PDB Compounds: (B:) Lignin peroxidase

SCOPe Domain Sequences for d1lgab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lgab_ a.93.1.1 (B:) Fungal peroxidase (ligninase) {Basidomycetes fungus (Phanerochaete chrysosporium) [TaxId: 5306]}
atcangktvgdasccawfdvlddiqanmfhggqcgaeahesirlvfhdsiaispameakg
kfggggadgsimifdtietafhpnigldevvamqkpfvqkhgvtpgdfiafagavalsnc
pgapqmnfftgrkpatqpapdglvpepfhtvdqiiarvndagefdelelvwmlsahsvaa
vndvdptvqglpfdstpgifdsqffvetqfrgtlfpgsggnqgevesgmageiriqtdht
lardsrtacewqsfvgnqsklvddfqfiflaltqlgqdpnamtdcsdviplskpipgngp
fsffppgkshsdieqacaetpfpslvtlpgpatsvaripph

SCOPe Domain Coordinates for d1lgab_:

Click to download the PDB-style file with coordinates for d1lgab_.
(The format of our PDB-style files is described here.)

Timeline for d1lgab_: