![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
![]() | Family d.144.1.6: APH phosphotransferases [64411] (5 proteins) |
![]() | Protein Type IIIa 3',5"-aminoglycoside phosphotransferase [64412] (1 species) |
![]() | Species Enterococcus faecalis [TaxId:1351] [64413] (8 PDB entries) |
![]() | Domain d3tm0a_: 3tm0 A: [185876] automated match to d1j7la_ complexed with anp, b31, mg |
PDB Entry: 3tm0 (more details), 2.1 Å
SCOPe Domain Sequences for d3tm0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tm0a_ d.144.1.6 (A:) Type IIIa 3',5"-aminoglycoside phosphotransferase {Enterococcus faecalis [TaxId: 1351]} akmrispelkkliekyrcvkdtegmspakvyklvgenenlylkmtdsrykgttydverek dmmlwlegklpvpkvlhferhdgwsnllmseadgvlcseeyedeqspekiielyaecirl fhsidisdcpytnsldsrlaeldyllnndladvdcenweedtpfkdprelydflktekpe eelvfshgdlgdsnifvkdgkvsgfidlgrsgradkwydiafcvrsiredigeeqyvelf fdllgikpdwekikyyilldelf
Timeline for d3tm0a_: