Lineage for d3tm0a_ (3tm0 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2979652Family d.144.1.6: APH phosphotransferases [64411] (5 proteins)
  6. 2979677Protein Type IIIa 3',5'-aminoglycoside phosphotransferase [64412] (1 species)
  7. 2979678Species Enterococcus faecalis [TaxId:1351] [64413] (10 PDB entries)
  8. 2979679Domain d3tm0a_: 3tm0 A: [185876]
    automated match to d1j7la_
    complexed with anp, b31, mg

Details for d3tm0a_

PDB Entry: 3tm0 (more details), 2.1 Å

PDB Description: Crystal Structure of 3',5"-Aminoglycoside Phosphotransferase Type IIIa AMPPNP Butirosin A Complex
PDB Compounds: (A:) Aminoglycoside 3'-phosphotransferase

SCOPe Domain Sequences for d3tm0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tm0a_ d.144.1.6 (A:) Type IIIa 3',5'-aminoglycoside phosphotransferase {Enterococcus faecalis [TaxId: 1351]}
akmrispelkkliekyrcvkdtegmspakvyklvgenenlylkmtdsrykgttydverek
dmmlwlegklpvpkvlhferhdgwsnllmseadgvlcseeyedeqspekiielyaecirl
fhsidisdcpytnsldsrlaeldyllnndladvdcenweedtpfkdprelydflktekpe
eelvfshgdlgdsnifvkdgkvsgfidlgrsgradkwydiafcvrsiredigeeqyvelf
fdllgikpdwekikyyilldelf

SCOPe Domain Coordinates for d3tm0a_:

Click to download the PDB-style file with coordinates for d3tm0a_.
(The format of our PDB-style files is described here.)

Timeline for d3tm0a_: