Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.0: automated matches [191346] (1 protein) not a true family |
Protein automated matches [190246] (71 species) not a true protein |
Species Mycobacterium avium [TaxId:1770] [189738] (3 PDB entries) |
Domain d3tlff_: 3tlf F: [185875] automated match to d1duba_ complexed with edo |
PDB Entry: 3tlf (more details), 2.15 Å
SCOPe Domain Sequences for d3tlff_:
Sequence, based on SEQRES records: (download)
>d3tlff_ c.14.1.0 (F:) automated matches {Mycobacterium avium [TaxId: 1770]} sfdtikyevdghtatitlnrpdalnalsphmitelraayheaenddrvwllvvtgtgraf csgadvkeipedgkviyerpylstydqweapqegtppfrtmakpvltavngiccgagmdw vtttdiviaseqatffdphvsiglvagrelvrvsrvlprsialrmalmgkhermsaqray elgliseivehdrlleraheiadivnsnaplavrgtrlailkglnvplheaeilaetfre rvlrtedaaegprafvekrqpnwqcr
>d3tlff_ c.14.1.0 (F:) automated matches {Mycobacterium avium [TaxId: 1770]} sfdtikyevdghtatitlnrpdalnalsphmitelraayheaenddrvwllvvtgtgraf csgadvpylstydqweapqegtppfrtmakpvltavngiccgagmdwvtttdiviaseqa tffdphvsiglvagrelvrvsrvlprsialrmalmgkhermsaqrayelgliseivehdr lleraheiadivnsnaplavrgtrlailkglnvplheaeilaetfrervlrtedaaegpr afvekrqpnwqcr
Timeline for d3tlff_: