SCOPe 2.07: Domain d3tkdb_: 3tkd B:

Lineage for d3tkdb_ (3tkd B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)

6. Protein Glutamate receptor ligand binding core [53881] (5 species)

7. Species Norway rat (Rattus norvegicus), GluR2 [TaxId:10116] [53882] (157 PDB entries)

8. Domain d3tkdb_: 3tkd B: [185866]
   Other proteins in same PDB: d3tkda2
   automated match to d1lb8a_
   complexed with cyz, glu, gol, so4

Details for d3tkdb_

PDB Entry: 3tkd, 1.45 Å

PDB Description: crystal structure of the glua2 ligand-binding domain (s1s2j-l483y- n754s) in complex with glutamate and cyclothiazide at 1.45 a resolution

PDB Compounds: (B:) Glutamate receptor 2

SCOPe Domain Sequences for d3tkdb_:

Sequence; same for both SEQRES and ATOM records:

>d3tkdb_ c.94.1.1 (B:) Glutamate receptor ligand binding core {Norway rat (Rattus norvegicus), GluR2 [TaxId: 10116]}
ktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyga
rdadtkiwngmvgelvygkadiaiapltityvreevidfskpfmslgisimikkgtpies
aedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvrk
skgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlklse
qglldklknkwwydkgecgs

Timeline for d3tkdb_:

• d3tkdb_ first appeared in SCOPe 2.01
  
• d3tkdb_ appears in SCOPe 2.06
  
• d3tkdb_ appears in the current release, SCOPe 2.08