| Class b: All beta proteins [48724] (180 folds) |
| Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) ![]() |
| Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
| Protein automated matches [190044] (14 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187233] (141 PDB entries) |
| Domain d3tjua_: 3tju A: [185861] automated match to d1iaua_ complexed with so4 |
PDB Entry: 3tju (more details), 2.7 Å
SCOPe Domain Sequences for d3tjua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tjua_ b.47.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iiggheakphsrpymafvqflqeksrkrcggilvrkdfvltaahcqgssinvtlgahnik
eqertqqfipvkrpiphpaynpknfsnnimllqlerkakwttavrplrlpsskaqvkpgq
lcsvagwgyvsmstlattlqevlltvqkdcqcerlfhgnysrateicvgdpkktqtgfkg
dsggplvckdvaqgilsygnkkgtppgvyikvshflpwikrtmkr
Timeline for d3tjua_: