Lineage for d1qpab_ (1qpa B:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 215901Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 215902Superfamily a.93.1: Heme-dependent peroxidases [48113] (3 families) (S)
  5. 215903Family a.93.1.1: CCP-like [48114] (6 proteins)
  6. 215990Protein Lignin peroxidase [48115] (1 species)
  7. 215991Species White rot basidiomycete (Phanerochaete chrysosporium) [TaxId:5306] [48116] (6 PDB entries)
  8. 216000Domain d1qpab_: 1qpa B: [18586]
    complexed with ca, fuc, hem, man, nag

Details for d1qpab_

PDB Entry: 1qpa (more details), 1.8 Å

PDB Description: lignin peroxidase isozyme lip4.65 (pi 4.65)

SCOP Domain Sequences for d1qpab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qpab_ a.93.1.1 (B:) Lignin peroxidase {White rot basidiomycete (Phanerochaete chrysosporium)}
vacpdgvhtasnaaccawfpvlddiqqnlfhggqcgaeahealrmvfhdsiaispklqsq
gkfggggadgsiitfssiettyhpnigldevvaiqkpfiakhgvtpgdfiafagavgvsn
cpgapqmqfflgrpeatqaapdglvpepfhtidqvlarmldaggfdeietvwllsahsia
aandvdptisglpfdstpgqfdsqffvetqlrgtafpgktgiqgtvmsplkgemrlqtdh
lfardsrtacewqsfvnnqtklqedfqfiftalstlghdmnamidcsevipapkpvnfgp
sffpagkthadieqacastpfptlitapgpsasvarippppspn

SCOP Domain Coordinates for d1qpab_:

Click to download the PDB-style file with coordinates for d1qpab_.
(The format of our PDB-style files is described here.)

Timeline for d1qpab_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1qpaa_