Lineage for d1qpaa_ (1qpa A:)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 99645Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
  4. 99646Superfamily a.93.1: Heme-dependent peroxidases [48113] (2 families) (S)
  5. 99647Family a.93.1.1: Cytochrome c peroxidase-like [48114] (6 proteins)
  6. 99730Protein Lignin peroxidase [48115] (1 species)
  7. 99731Species White rot basidiomycete (Phanerochaete chrysosporium) [TaxId:5306] [48116] (6 PDB entries)
  8. 99739Domain d1qpaa_: 1qpa A: [18585]

Details for d1qpaa_

PDB Entry: 1qpa (more details), 1.8 Å

PDB Description: lignin peroxidase isozyme lip4.65 (pi 4.65)

SCOP Domain Sequences for d1qpaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qpaa_ a.93.1.1 (A:) Lignin peroxidase {White rot basidiomycete (Phanerochaete chrysosporium)}
vacpdgvhtasnaaccawfpvlddiqqnlfhggqcgaeahealrmvfhdsiaispklqsq
gkfggggadgsiitfssiettyhpnigldevvaiqkpfiakhgvtpgdfiafagavgvsn
cpgapqmqfflgrpeatqaapdglvpepfhtidqvlarmldaggfdeietvwllsahsia
aandvdptisglpfdstpgqfdsqffvetqlrgtafpgktgiqgtvmsplkgemrlqtdh
lfardsrtacewqsfvnnqtklqedfqfiftalstlghdmnamidcsevipapkpvnfgp
sffpagkthadieqacastpfptlitapgpsasvarippppspn

SCOP Domain Coordinates for d1qpaa_:

Click to download the PDB-style file with coordinates for d1qpaa_.
(The format of our PDB-style files is described here.)

Timeline for d1qpaa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1qpab_