Lineage for d3thsb_ (3ths B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2129396Family c.66.1.5: Glycine N-methyltransferase [53348] (1 protein)
  6. 2129397Protein Glycine N-methyltransferase [53349] (3 species)
  7. 2129414Species Norway rat (Rattus norvegicus) [TaxId:10116] [53350] (12 PDB entries)
  8. 2129430Domain d3thsb_: 3ths B: [185844]
    automated match to d1bhja_
    complexed with bme, tam

Details for d3thsb_

PDB Entry: 3ths (more details), 2.5 Å

PDB Description: Crystal structure of rat native liver Glycine N-methyltransferase complexed with 5-methyltetrahydrofolate pentaglutamate
PDB Compounds: (B:) glycine n-methyltransferase

SCOPe Domain Sequences for d3thsb_:

Sequence, based on SEQRES records: (download)

>d3thsb_ c.66.1.5 (B:) Glycine N-methyltransferase {Norway rat (Rattus norvegicus) [TaxId: 10116]}
vdsvyrtrslgvaaegipdqyadgeaarvwqlyigdtrsrtaeykawllgllrqhgchrv
ldvacgtgvdsimlveegfsvtsvdasdkmlkyalkerwnrrkepafdkwvieeanwltl
dkdvpagdgfdaviclgnsfahlpdskgdqsehrlalkniasmvrpggllvidhrnydyi
lstgcappgkniyyksdltkdittsvltvnnkahmvtldytvqvpgagrdgapgfskfrl
syyphclasftelvqeafggrcqhsvlgdfkpyrpgqayvpcyfihvlkktg

Sequence, based on observed residues (ATOM records): (download)

>d3thsb_ c.66.1.5 (B:) Glycine N-methyltransferase {Norway rat (Rattus norvegicus) [TaxId: 10116]}
vdsvyrtrslgvaaegipdqyadgeaarvwqlyigdtrsrtaeykawllgllrqhgchrv
ldvacgtgvdsimlveegfsvtsvdasdkmlkyalkerwnrrkepafdkwvieeanwltl
dkdvpagdgfdaviclgnsfahlpdskgdqsehrlalkniasmvrpggllvidhrnydyi
lstgcappgkniyyksdltkdittsvltvnnkahmvtldytvqvppgfskfrlsyyphcl
asftelvqeafggrcqhsvlgdfkpyrpgqayvpcyfihvlkktg

SCOPe Domain Coordinates for d3thsb_:

Click to download the PDB-style file with coordinates for d3thsb_.
(The format of our PDB-style files is described here.)

Timeline for d3thsb_: