SCOPe 2.08: Domain d3thkb_: 3thk B:

Lineage for d3thkb_ (3thk B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.1: SH3-domain [50045] (40 proteins)

6. Protein automated matches [190043] (8 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [187407] (7 PDB entries)

8. Domain d3thkb_: 3thk B: [185838]
   automated match to d1pwta_
   complexed with bme, so4

Details for d3thkb_

PDB Entry: 3thk, 1.7 Å

PDB Description: Structure of SH3 chimera with a type II ligand linked to the chain C-terminal

PDB Compounds: (B:) Spectrin alpha chain, brain

SCOPe Domain Sequences for d3thkb_:

Sequence; same for both SEQRES and ATOM records:

>d3thkb_ b.34.2.1 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
kelvlalydyqeksprevtmkkgdiltllnstnkdwwkvevndrqgfvpaayvkkldp

Timeline for d3thkb_:

• d3thkb_ first appeared in SCOPe 2.01
  
• d3thkb_ appears in SCOPe 2.07