SCOPe 2.06: Domain d3thjb_: 3thj B:

Lineage for d3thjb_ (3thj B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
   3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456

4. Superfamily c.42.1: Arginase/deacetylase [52768] (3 families)

5. Family c.42.1.1: Arginase-like amidino hydrolases [52769] (5 proteins)
   Pfam PF00491

6. Protein Arginase [52770] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [142346] (26 PDB entries)
   Uniprot P05089 5-313

8. Domain d3thjb_: 3thj B: [185836]
   automated match to d1wvaa1
   complexed with co, orn

Details for d3thjb_

PDB Entry: 3thj, 1.5 Å

PDB Description: crystal structure of the co2+2-hai-l-orn complex

PDB Compounds: (B:) Arginase-1

SCOPe Domain Sequences for d3thjb_:

Sequence; same for both SEQRES and ATOM records:

>d3thjb_ c.42.1.1 (B:) Arginase {Human (Homo sapiens) [TaxId: 9606]}
rtigiigapfskgqprggveegptvlrkaglleklkeqecdvkdygdlpfadipndspfq
ivknprsvgkaseqlagkvaevkkngrislvlggdhslaigsisgharvhpdlgviwvda
htdintpltttsgnlhgqpvsfllkelkgkipdvpgfswvtpcisakdivyiglrdvdpg
ehyilktlgikyfsmtevdrlgigkvmeetlsyllgrkkrpihlsfdvdgldpsftpatg
tpvvggltyreglyiteeiyktgllsgldimevnpslgktpeevtrtvntavaitlacfg
laregnhkpidyln

Timeline for d3thjb_:

• d3thjb_ first appeared in SCOPe 2.01
  
• d3thjb_ appears in SCOPe 2.05
  
• d3thjb_ appears in SCOPe 2.07
  
• d3thjb_ appears in the current release, SCOPe 2.08