Lineage for d3thjb_ (3thj B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129859Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456
  4. 2129860Superfamily c.42.1: Arginase/deacetylase [52768] (3 families) (S)
  5. 2129861Family c.42.1.1: Arginase-like amidino hydrolases [52769] (5 proteins)
    Pfam PF00491
  6. 2129882Protein Arginase [52770] (5 species)
  7. 2129914Species Human (Homo sapiens) [TaxId:9606] [142346] (26 PDB entries)
    Uniprot P05089 5-313
  8. 2129935Domain d3thjb_: 3thj B: [185836]
    automated match to d1wvaa1
    complexed with co, orn

Details for d3thjb_

PDB Entry: 3thj (more details), 1.5 Å

PDB Description: crystal structure of the co2+2-hai-l-orn complex
PDB Compounds: (B:) Arginase-1

SCOPe Domain Sequences for d3thjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3thjb_ c.42.1.1 (B:) Arginase {Human (Homo sapiens) [TaxId: 9606]}
rtigiigapfskgqprggveegptvlrkaglleklkeqecdvkdygdlpfadipndspfq
ivknprsvgkaseqlagkvaevkkngrislvlggdhslaigsisgharvhpdlgviwvda
htdintpltttsgnlhgqpvsfllkelkgkipdvpgfswvtpcisakdivyiglrdvdpg
ehyilktlgikyfsmtevdrlgigkvmeetlsyllgrkkrpihlsfdvdgldpsftpatg
tpvvggltyreglyiteeiyktgllsgldimevnpslgktpeevtrtvntavaitlacfg
laregnhkpidyln

SCOPe Domain Coordinates for d3thjb_:

Click to download the PDB-style file with coordinates for d3thjb_.
(The format of our PDB-style files is described here.)

Timeline for d3thjb_: