Lineage for d3th9a_ (3th9 A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1548217Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 1548218Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 1548219Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 1548235Protein Human immunodeficiency virus type 1 protease [50632] (8 species)
  7. 1548436Species Human immunodeficiency virus type 1 lw12.3 isolate [TaxId:82834] [189723] (3 PDB entries)
  8. 1548437Domain d3th9a_: 3th9 A: [185829]
    automated match to d1a30a_
    complexed with 9y9; mutant

Details for d3th9a_

PDB Entry: 3th9 (more details), 1.34 Å

PDB Description: Crystal Structure of HIV-1 Protease Mutant Q7K V32I L63I with a cyclic sulfonamide inhibitor
PDB Compounds: (A:) Gag-Pol polyprotein

SCOPe Domain Sequences for d3th9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3th9a_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 lw12.3 isolate [TaxId: 82834]}
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
qiiieicghkaigtvlvgptpvniigrnlltqigctlnf

SCOPe Domain Coordinates for d3th9a_:

Click to download the PDB-style file with coordinates for d3th9a_.
(The format of our PDB-style files is described here.)

Timeline for d3th9a_: