SCOPe 2.01: Domain d3th9a_: 3th9 A:

Lineage for d3th9a_ (3th9 A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Human immunodeficiency virus type 1 protease [50632] (5 species)

7. Species Human immunodeficiency virus type 1 lw12.3 isolate [TaxId:82834] [189723] (1 PDB entry)

8. Domain d3th9a_: 3th9 A: [185829]
   automated match to d1a30a_
   complexed with 9y9; mutant

Details for d3th9a_

PDB Entry: 3th9, 1.34 Å

PDB Description: Crystal Structure of HIV-1 Protease Mutant Q7K V32I L63I with a cyclic sulfonamide inhibitor

PDB Compounds: (A:) Gag-Pol polyprotein

SCOPe Domain Sequences for d3th9a_:

Sequence; same for both SEQRES and ATOM records:

>d3th9a_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 lw12.3 isolate [TaxId: 82834]}
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
qiiieicghkaigtvlvgptpvniigrnlltqigctlnf

Timeline for d3th9a_:

• d3th9a_ is new in SCOPe 2.01-stable
  
• d3th9a_ appears in SCOPe 2.02
  
• d3th9a_ appears in the current release, SCOPe 2.08