Lineage for d3tgmb_ (3tgm B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2345656Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 2345657Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 2345658Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (4 proteins)
    automatically mapped to Pfam PF01126
  6. 2345704Protein Heme oxygenase-1 (HO-1) [48615] (3 species)
  7. 2345705Species Human (Homo sapiens) [TaxId:9606] [48616] (26 PDB entries)
    Uniprot P09601
  8. 2345759Domain d3tgmb_: 3tgm B: [185825]
    automated match to d1ni6c_
    complexed with 3tg, hem, hez

Details for d3tgmb_

PDB Entry: 3tgm (more details), 2.85 Å

PDB Description: X-Ray Crystal Structure of Human Heme Oxygenase-1 in Complex with 1-(1H-imidazol-1-yl)-4,4-diphenyl-2 butanone
PDB Compounds: (B:) Heme oxygenase 1

SCOPe Domain Sequences for d3tgmb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tgmb_ a.132.1.1 (B:) Heme oxygenase-1 (HO-1) {Human (Homo sapiens) [TaxId: 9606]}
pqdlsealkeatkevhtqaenaefmrnfqkgqvtrdgfklvmaslyhiyvaleeeiernk
espvfapvyfpeelhrkaaleqdlafwygprwqevipytpamqryvkrlhevgrtepell
vahaytrylgdlsggqvlkkiaqkaldlpssgeglafftfpniasatkfkqlyrsrmnsl
emtpavrqrvieeaktafllniqlfeelqellthd

SCOPe Domain Coordinates for d3tgmb_:

Click to download the PDB-style file with coordinates for d3tgmb_.
(The format of our PDB-style files is described here.)

Timeline for d3tgmb_: