Lineage for d3tgma_ (3tgm A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 925023Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 925024Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 925025Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (4 proteins)
  6. 925061Protein Heme oxygenase-1 (HO-1) [48615] (3 species)
  7. 925062Species Human (Homo sapiens) [TaxId:9606] [48616] (23 PDB entries)
    Uniprot P09601
  8. 925111Domain d3tgma_: 3tgm A: [185824]
    automated match to d1ni6c_
    complexed with 3tg, hem, hez

Details for d3tgma_

PDB Entry: 3tgm (more details), 2.85 Å

PDB Description: X-Ray Crystal Structure of Human Heme Oxygenase-1 in Complex with 1-(1H-imidazol-1-yl)-4,4-diphenyl-2 butanone
PDB Compounds: (A:) Heme oxygenase 1

SCOPe Domain Sequences for d3tgma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tgma_ a.132.1.1 (A:) Heme oxygenase-1 (HO-1) {Human (Homo sapiens) [TaxId: 9606]}
pqdlsealkeatkevhtqaenaefmrnfqkgqvtrdgfklvmaslyhiyvaleeeiernk
espvfapvyfpeelhrkaaleqdlafwygprwqevipytpamqryvkrlhevgrtepell
vahaytrylgdlsggqvlkkiaqkaldlpssgeglafftfpniasatkfkqlyrsrmnsl
emtpavrqrvieeaktafllniqlfeelqellth

SCOPe Domain Coordinates for d3tgma_:

Click to download the PDB-style file with coordinates for d3tgma_.
(The format of our PDB-style files is described here.)

Timeline for d3tgma_: