Class a: All alpha proteins [46456] (289 folds) |
Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily) multihelical; consists of two different alpha-helical bundles |
Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) |
Family a.211.1.2: PDEase [48548] (7 proteins) Pfam PF00233; multihelical; can be divided into three subdomains |
Protein cGMP-specific 3',5'-cyclic phosphodiesterase pde5a1-Ibmx [101439] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [101440] (26 PDB entries) Uniprot O76074 534-860 |
Domain d3tgea_: 3tge A: [185822] automated match to d1t9sa_ complexed with mg, tge, zn |
PDB Entry: 3tge (more details), 1.96 Å
SCOPe Domain Sequences for d3tgea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tgea_ a.211.1.2 (A:) cGMP-specific 3',5'-cyclic phosphodiesterase pde5a1-Ibmx {Human (Homo sapiens) [TaxId: 9606]} etrelqslaaavvpsaqtlkitdfsfsdfelsdletalctirmftdlnlvqnfqmkhevl crwilsvkknyrknvayhnwrhafntaqcmfaalkagkiqnkltdleilalliaalshdl dhpgvsnqflintnselalmyndesvlehhhfdqclmilnspgnqilsglsieeykttlk iikqailatdlalyikrrgeffelirknqfnledphekelflamlmtacdlsaitkpwpi qqriaelvateffdqgdrerkelnieptdlmnrekknkipsmqvgfidaiclqlyealth vsedcfplldgcrknrqkwqalae
Timeline for d3tgea_: