Lineage for d3tg0c_ (3tg0 C:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2513017Fold c.76: Alkaline phosphatase-like [53648] (1 superfamily)
    core:3 layers: a/b/a; mixed beta-sheet of 8 strands, order 43516728, strand 7 is antiparallel to the rest
  4. 2513018Superfamily c.76.1: Alkaline phosphatase-like [53649] (6 families) (S)
  5. 2513019Family c.76.1.1: Alkaline phosphatase [53650] (2 proteins)
    common fold is decorated with several large insertions
    automatically mapped to Pfam PF00245
  6. 2513020Protein Alkaline phosphatase [53651] (4 species)
  7. 2513021Species Escherichia coli K-12 [TaxId:83333] [224910] (2 PDB entries)
  8. 2513024Domain d3tg0c_: 3tg0 C: [185820]
    automated match to d1ajaa_
    complexed with mg, po4, zn

Details for d3tg0c_

PDB Entry: 3tg0 (more details), 1.2 Å

PDB Description: E. coli alkaline phosphatase with bound inorganic phosphate
PDB Compounds: (C:) alkaline phosphatase

SCOPe Domain Sequences for d3tg0c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tg0c_ c.76.1.1 (C:) Alkaline phosphatase {Escherichia coli K-12 [TaxId: 83333]}
nraaqgditapggarrltgdqtaalrdslsdkpakniilligdgmgdseitaarnyaega
ggffkgidalpltgqythyalnkktgkpdyvtdsaasatawstgvktyngalgvdihekd
hptilemakaaglatgnvstaelqdatpaalvahvtsrkcygpsatsekcpgnalekggk
gsiteqllnaradvtlgggaktfaetatagewqgktlreqaqargyqlvsdaaslnsvte
anqqkpllglfadgnmpvrwlgpkatyhgnidkpavtctpnpqrndsvptlaqmtdkaie
llsknekgfflqvegasidkqdhaanpcgqigetvdldeavqralefakkegntlvivta
dhahasqivapdtkapgltqalntkdgavmvmsygnseedsqehtgsqlriaaygphaan
vvgltdqtdlfytmkaalgl

SCOPe Domain Coordinates for d3tg0c_:

Click to download the PDB-style file with coordinates for d3tg0c_.
(The format of our PDB-style files is described here.)

Timeline for d3tg0c_: