Lineage for d3tg0b_ (3tg0 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2138453Fold c.76: Alkaline phosphatase-like [53648] (1 superfamily)
    core:3 layers: a/b/a; mixed beta-sheet of 8 strands, order 43516728, strand 7 is antiparallel to the rest
  4. 2138454Superfamily c.76.1: Alkaline phosphatase-like [53649] (6 families) (S)
  5. 2138455Family c.76.1.1: Alkaline phosphatase [53650] (2 protein domains)
    common fold is decorated with several large insertions
    automatically mapped to Pfam PF00245
  6. 2138456Protein Alkaline phosphatase [53651] (4 species)
  7. 2138457Species Escherichia coli K-12 [TaxId:83333] [224910] (2 PDB entries)
  8. 2138459Domain d3tg0b_: 3tg0 B: [185819]
    automated match to d1ajaa_
    complexed with mg, po4, zn

Details for d3tg0b_

PDB Entry: 3tg0 (more details), 1.2 Å

PDB Description: E. coli alkaline phosphatase with bound inorganic phosphate
PDB Compounds: (B:) alkaline phosphatase

SCOPe Domain Sequences for d3tg0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tg0b_ c.76.1.1 (B:) Alkaline phosphatase {Escherichia coli K-12 [TaxId: 83333]}
nraaqgditapggarrltgdqtaalrdslsdkpakniilligdgmgdseitaarnyaega
ggffkgidalpltgqythyalnkktgkpdyvtdsaasatawstgvktyngalgvdihekd
hptilemakaaglatgnvstaelqdatpaalvahvtsrkcygpsatsekcpgnalekggk
gsiteqllnaradvtlgggaktfaetatagewqgktlreqaqargyqlvsdaaslnsvte
anqqkpllglfadgnmpvrwlgpkatyhgnidkpavtctpnpqrndsvptlaqmtdkaie
llsknekgfflqvegasidkqdhaanpcgqigetvdldeavqralefakkegntlvivta
dhahasqivapdtkapgltqalntkdgavmvmsygnseedsqehtgsqlriaaygphaan
vvgltdqtdlfytmkaalgl

SCOPe Domain Coordinates for d3tg0b_:

Click to download the PDB-style file with coordinates for d3tg0b_.
(The format of our PDB-style files is described here.)

Timeline for d3tg0b_: