SCOPe 2.02: Domain d3tfqa_: 3tfq A:

Lineage for d3tfqa_ (3tfq A:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
   also known as short-chain dehydrogenases and SDR family
   parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

6. Protein 11-beta-hydroxysteroid dehydrogenase 1 [117423] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [117424] (20 PDB entries)
   Uniprot P28845

8. Domain d3tfqa_: 3tfq A: [185814]
   automated match to d1xu9a_
   complexed with 07m, gol, nap; mutant

Details for d3tfqa_

PDB Entry: 3tfq, 1.8 Å

PDB Description: crystal structure of 11b-hsd1 double mutant (l262r, f278e) complexed with 8-{[(2-cyanopyridin-3-yl)methyl]sulfanyl}-6-hydroxy-3,4-dihydro-1h-pyrano[3,4-c]pyridine-5-carbonitrile

PDB Compounds: (A:) Corticosteroid 11-beta-dehydrogenase isozyme 1

SCOPe Domain Sequences for d3tfqa_:

Sequence; same for both SEQRES and ATOM records:

>d3tfqa_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]}
efrpemlqgkkvivtgaskgigremayhlakmgahvvvtarsketlqkvvshclelgaas
ahyiagtmedmtfaeqfvaqagklmggldmlilnhitntslnlfhddihhvrksmevnfl
syvvltvaalpmlkqsngsivvvsslagkvaypmvaaysaskfaldgffssirkeysvsr
vnvsitlcvlglidtetamkavsgivhmqaapkeecaleiikggalrqeevyydssrwtt
llirnpcrkileelystsynmd

Timeline for d3tfqa_:

• d3tfqa_ first appeared in SCOPe 2.01
  
• d3tfqa_ appears in SCOPe 2.03
  
• d3tfqa_ appears in the current release, SCOPe 2.08