Lineage for d3tdha_ (3tdh A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1040331Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 1040830Superfamily d.129.6: KA1-like [103243] (2 families) (S)
    contains a single copy of this fold
  5. 1040839Family d.129.6.2: Ssp2 C-terminal domain-like [160723] (4 proteins)
    PfamB PB166430
  6. 1040861Protein automated matches [190788] (2 species)
    not a true protein
  7. 1040868Species Saccharomyces cerevisiae [TaxId:559292] [189800] (3 PDB entries)
  8. 1040870Domain d3tdha_: 3tdh A: [185794]
    automated match to d2qlva1
    complexed with amp

Details for d3tdha_

PDB Entry: 3tdh (more details), 2.3 Å

PDB Description: Structure of the regulatory fragment of sccharomyces cerevisiae AMPK in complex with AMP
PDB Compounds: (A:) Carbon catabolite-derepressing protein kinase

SCOPe Domain Sequences for d3tdha_:

Sequence, based on SEQRES records: (download)

>d3tdha_ d.129.6.2 (A:) automated matches {Saccharomyces cerevisiae [TaxId: 559292]}
stvsilptslpqihranmlaqgspaaskisplvtkksktrwhfgirsrsypldvmgeiyi
alknlgaewakpseedlwtiklrwkydignktntnekipdlmkmviqlfqietnnylvdf
kfdgwessygddttvsnisedemstfsaypflhlttklimelavns

Sequence, based on observed residues (ATOM records): (download)

>d3tdha_ d.129.6.2 (A:) automated matches {Saccharomyces cerevisiae [TaxId: 559292]}
stvsilptslpqihranmlaqgspaaskisplvtkksktrwhfgirsrsypldvmgeiyi
alknlgaewakpseedlwtiklrwkyipdlmkmviqlfqietnnylvdfkfdgwesstfs
aypflhlttklimelavns

SCOPe Domain Coordinates for d3tdha_:

Click to download the PDB-style file with coordinates for d3tdha_.
(The format of our PDB-style files is described here.)

Timeline for d3tdha_: