Lineage for d1llp__ (1llp -)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 215901Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 215902Superfamily a.93.1: Heme-dependent peroxidases [48113] (3 families) (S)
  5. 215903Family a.93.1.1: CCP-like [48114] (6 proteins)
  6. 215990Protein Lignin peroxidase [48115] (1 species)
  7. 215991Species White rot basidiomycete (Phanerochaete chrysosporium) [TaxId:5306] [48116] (6 PDB entries)
  8. 215992Domain d1llp__: 1llp - [18578]
    complexed with ca, hem, hyd, man, nag, nga

Details for d1llp__

PDB Entry: 1llp (more details), 1.7 Å

PDB Description: lignin peroxidase (isozyme h2) pi 4.15

SCOP Domain Sequences for d1llp__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1llp__ a.93.1.1 (-) Lignin peroxidase {White rot basidiomycete (Phanerochaete chrysosporium)}
atcangktvgdasccawfdvlddiqanmfhggqcgaeahesirlvfhdsiaispameakg
kfggggadgsimifdtietafhpnigldevvamqkpfvqkhgvtpgdfiafagavalsnc
pgapqmnfftgrkpatqpapdglvpepfhtvdqiiarvndagefdelelvwmlsahsvaa
vndvdptvqglpfdstpgifdsqffvetqfrgtlfpgsggnqgevesgmageiriqtdht
lardsrtacewqsfvgnqsklvddfqfiflaltqlgqdpnamtdcsdviplskpipgngp
fsffppgkshsdieqacaetpfpslvtlpgpatsvaripphka

SCOP Domain Coordinates for d1llp__:

Click to download the PDB-style file with coordinates for d1llp__.
(The format of our PDB-style files is described here.)

Timeline for d1llp__: