Lineage for d1llp__ (1llp -)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 99645Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
  4. 99646Superfamily a.93.1: Heme-dependent peroxidases [48113] (2 families) (S)
  5. 99647Family a.93.1.1: Cytochrome c peroxidase-like [48114] (6 proteins)
  6. 99730Protein Lignin peroxidase [48115] (1 species)
  7. 99731Species White rot basidiomycete (Phanerochaete chrysosporium) [TaxId:5306] [48116] (6 PDB entries)
  8. 99732Domain d1llp__: 1llp - [18578]

Details for d1llp__

PDB Entry: 1llp (more details), 1.7 Å

PDB Description: lignin peroxidase (isozyme h2) pi 4.15

SCOP Domain Sequences for d1llp__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1llp__ a.93.1.1 (-) Lignin peroxidase {White rot basidiomycete (Phanerochaete chrysosporium)}
atcangktvgdasccawfdvlddiqanmfhggqcgaeahesirlvfhdsiaispameakg
kfggggadgsimifdtietafhpnigldevvamqkpfvqkhgvtpgdfiafagavalsnc
pgapqmnfftgrkpatqpapdglvpepfhtvdqiiarvndagefdelelvwmlsahsvaa
vndvdptvqglpfdstpgifdsqffvetqfrgtlfpgsggnqgevesgmageiriqtdht
lardsrtacewqsfvgnqsklvddfqfiflaltqlgqdpnamtdcsdviplskpipgngp
fsffppgkshsdieqacaetpfpslvtlpgpatsvaripphka

SCOP Domain Coordinates for d1llp__:

Click to download the PDB-style file with coordinates for d1llp__.
(The format of our PDB-style files is described here.)

Timeline for d1llp__: