Lineage for d1llpa_ (1llp A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2328246Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2328247Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2328248Family a.93.1.1: CCP-like [48114] (5 protein domains)
  6. 2328491Protein Fungal peroxidase (ligninase) [88935] (3 species)
  7. 2328507Species Basidomycetes fungus (Phanerochaete chrysosporium) [TaxId:5306] [48116] (9 PDB entries)
  8. 2328508Domain d1llpa_: 1llp A: [18578]
    complexed with a2g, ca, hem, man, nag, oh

Details for d1llpa_

PDB Entry: 1llp (more details), 1.7 Å

PDB Description: lignin peroxidase (isozyme h2) pi 4.15
PDB Compounds: (A:) Lignin peroxidase

SCOPe Domain Sequences for d1llpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1llpa_ a.93.1.1 (A:) Fungal peroxidase (ligninase) {Basidomycetes fungus (Phanerochaete chrysosporium) [TaxId: 5306]}
atcangktvgdasccawfdvlddiqanmfhggqcgaeahesirlvfhdsiaispameakg
kfggggadgsimifdtietafhpnigldevvamqkpfvqkhgvtpgdfiafagavalsnc
pgapqmnfftgrkpatqpapdglvpepfhtvdqiiarvndagefdelelvwmlsahsvaa
vndvdptvqglpfdstpgifdsqffvetqfrgtlfpgsggnqgevesgmageiriqtdht
lardsrtacewqsfvgnqsklvddfqfiflaltqlgqdpnamtdcsdviplskpipgngp
fsffppgkshsdieqacaetpfpslvtlpgpatsvaripphka

SCOPe Domain Coordinates for d1llpa_:

Click to download the PDB-style file with coordinates for d1llpa_.
(The format of our PDB-style files is described here.)

Timeline for d1llpa_: